Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-NUCB2 Antibody
| Applications | IHC, WB |
| Reactivities | Canine, Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NUCB2 antibody: synthetic peptide directed towards the middle region of human NUCB2. Synthetic peptide located within the following region: MMKEHERREYLKTLNEEKRKEEESKFEEMKKKHENHPKVNHPGSKDQLKE |
Rabbit Polyclonal Anti-NUCB2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NUCB2 antibody: synthetic peptide directed towards the C terminal of human NUCB2. Synthetic peptide located within the following region: FFTEEELKEYENIIALQENELKKKADELQKQKEELQRQHDQLEAQKLEYH |
Rabbit polyclonal anti Nesfatin-1 (24-38) (hu); neat antiserum
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
NUCB2 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 321-420 of human NUCB2 (NP_005004.1). |
| Modifications | Unmodified |
NUCB2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 321-420 of human NUCB2 (NP_005004.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- NUCB2