Rabbit Polyclonal Anti-NUDT16L1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NUDT16L1 antibody: synthetic peptide directed towards the middle region of human NUDT16L1. Synthetic peptide located within the following region: LNRVLGLGLGCLRLTEADYLSSHLTEGPHRVVAHLYARQLTLEQLHAVEI |
Rabbit Polyclonal Anti-NUDT16L1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NUDT16L1 antibody: synthetic peptide directed towards the C terminal of human NUDT16L1. Synthetic peptide located within the following region: GLVRVPLYTQKDRVGGFPNFLSNAFVSTAKCQLLFALKVLNMMPEEKLVE |
Germany
Japan
United Kingdom
China