Antibodies

Jump to Filters
View as table Download
NUDT3 Rabbit Polyclonal Antibody
TA332026

USD 375.00

5 Days

Rabbit Polyclonal Anti-NUDT3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-NUDT3 Antibody is: synthetic peptide directed towards the middle region of Human NUDT3. Synthetic peptide located within the following region: VKGTLGRLVGIFENQERKHRTYVYVLIVTEVLEDWEDSVNIGRKREWFKI