Germany
Japan
United Kingdom
China
Goat Anti-OAS1 Antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | Peptide with sequence C-THEYPHFSHRPST, from the internal region (near C terminus) of the protein sequence according to NP_058132.2. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-OAS1
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OAS1 antibody: synthetic peptide directed towards the middle region of human OAS1. Synthetic peptide located within the following region: RRQLTKPRPVILDPADPTGNLGGGDPKGWRQLAQEAEAWLNYPCFKNWDG |
Rabbit Polyclonal Anti-OAS1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OAS1 antibody: synthetic peptide directed towards the C terminal of human OAS1. Synthetic peptide located within the following region: GWRQLAQEAEAWLNYPCFKNWDGSPVSSWILLVRPPASSLPFIPAPLHEA |
OAS1 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human OAS1 |
OAS1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human OAS1 (NP_002525.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- OAS1