OCIAD2 (C-term) rabbit polyclonal antibody, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
Immunogen | OCIAD2 antibody was raised against synthetic peptide - KLH conjugated |
OCIAD2 (C-term) rabbit polyclonal antibody, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
Immunogen | OCIAD2 antibody was raised against synthetic peptide - KLH conjugated |
OCIAD2 (N-term) rabbit polyclonal antibody, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | OCIAD2 antibody was raised against synthetic peptide - KLH conjugated |
Rabbit Polyclonal OCIAD2 Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | OCIAD2 antibody was raised against an 18 amino acid peptide from near the carboxy terminus of human OCIAD2. |
Rabbit Polyclonal OCIAD2 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | OCIAD2 antibody was raised against a 17 amino acid peptide from near the amino terminus of human OCIAD2. |
Rabbit Polyclonal Anti-OCIAD2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-OCIAD2 antibody: synthetic peptide directed towards the middle region of human OCIAD2. Synthetic peptide located within the following region: QGYLAANSRFGSLPKVALAGLLGFGLGKVSYIGVCQSKFHFFEDQLRGAG |
Rabbit Polyclonal Anti-OCIAD2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human OCIAD2 |
Ociad2 Antibody - N-terminal region
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
OCIAD2 Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-99 of human OCIAD2 (NP_689611.1). |
Modifications | Unmodified |