Antibodies

View as table Download

Rabbit monoclonal anti-MIME antibody for SISCAPA, clone OTIR4H1

Applications SISCAPA
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

OIF (OGN) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 246-276 amino acids from the C-terminal region of Human Mimecan.

Rabbit Polyclonal Anti-Ogn Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Ogn antibody is: synthetic peptide directed towards the C-terminal region of Rat Ogn. Synthetic peptide located within the following region: LQFNSISSITDDTFCKANDTRYIRERMEEIRLEGNPIALGKHPNSFICLK

OGN Antibody - N-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human OGN

OGN Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 20-298 of human OGN (NP_148935.1).
Modifications Unmodified