Rabbit Polyclonal Anti-Olfm3 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Olfm3 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: PKRSAGESFMICGTLYVTNSHLTGAKVYYSYSTKTSTYEYTDIPFHNQYF |
Rabbit Polyclonal Anti-OLFM3 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human OLFM3 |
OLFM3 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human OLFM3. |
Germany
Japan
United Kingdom
China