Antibodies

View as table Download

Encephalopsin (OPN3) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse
Immunogen Synthetic peptide corresponding to amino acids 176-220 of Human Encephalopsin.

Rabbit polyclonal Encephalopsin antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Encephalopsin.

Rabbit Polyclonal Opsin 3 Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.

Rabbit polyclonal anti-OPN3 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OPN3.

Rabbit Polyclonal Anti-OPN3 Antibody (C-Terminus)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Encephalopsin / OPN3 antibody was raised against synthetic 19 amino acid peptide from C-terminus of human OPN3 / Encephalopsin. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey (100%); Dog, Panda (95%); Marmoset, Rat, Elephant (89%); Mouse, Horse (84%).

Rabbit Polyclonal Anti-OPN3 Antibody (C-Terminus)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Encephalopsin / OPN3 antibody was raised against synthetic 16 amino acid peptide from C-terminus of human OPN3 / Encephalopsin. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey, Marmoset (94%); Panda (81%).

Rabbit Polyclonal Anti-OPN3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OPN3 antibody: synthetic peptide directed towards the C terminal of human OPN3. Synthetic peptide located within the following region: IVMSQKDGDRPKKKVTFNSSSIIFIITSDESLSVDDSDKTNGSKVDVIQV

Opn3 Antibody - C-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated

OPN3 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 300-400 of human OPN3 (NP_055137.2).
Modifications Unmodified