Germany
Japan
United Kingdom
China
Encephalopsin (OPN3) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide corresponding to amino acids 176-220 of Human Encephalopsin. |
Antibodies
View as table Download
Rabbit polyclonal anti-OPN3 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human OPN3. |
Rabbit Polyclonal Anti-OPN3 Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Encephalopsin / OPN3 antibody was raised against synthetic 19 amino acid peptide from C-terminus of human OPN3 / Encephalopsin. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey (100%); Dog, Panda (95%); Marmoset, Rat, Elephant (89%); Mouse, Horse (84%). |
Rabbit Polyclonal Anti-OPN3 Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Encephalopsin / OPN3 antibody was raised against synthetic 16 amino acid peptide from C-terminus of human OPN3 / Encephalopsin. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey, Marmoset (94%); Panda (81%). |
Rabbit Polyclonal Anti-OPN3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OPN3 antibody: synthetic peptide directed towards the C terminal of human OPN3. Synthetic peptide located within the following region: IVMSQKDGDRPKKKVTFNSSSIIFIITSDESLSVDDSDKTNGSKVDVIQV |
Opn3 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
OPN3 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 300-400 of human OPN3 (NP_055137.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- OPN3