Antibodies

View as table Download

Rabbit anti-OPTN Polyclonal Antibody

Applications ELISA, IHC, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated

Optineurin Rabbit Polyclonal (aa575-591) Antibody

Applications IHC
Reactivities Bat, Gibbon, Dog, Gorilla, Horse, Human, Monkey, Mouse, Orang-Utan, Rabbit, Rat
Conjugation Unconjugated
Immunogen OPTN / Optineurin antibody was raised against synthetic peptide corresponding to aa 559-575 (GEVLPDIDTLQIHVMDC) of human, mouse and rat optineurin

Rabbit Polyclonal Anti-OPTN Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OPTN antibody: synthetic peptide directed towards the N terminal of human OPTN. Synthetic peptide located within the following region: SHQPLSCLTEKEDSPSESTGNGPPHLAHPNLDTFTPEELLQQMKELLTEN

Rabbit Polyclonal Anti-OPTN Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OPTN antibody: synthetic peptide directed towards the N terminal of human OPTN. Synthetic peptide located within the following region: LSAWTEKQKEERQFFEIQSKEAKERLMALSHENEKLKEELGKLKGKSERS

Rabbit Polyclonal Anti-OPTN Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OPTN Antibody: synthetic peptide directed towards the C terminal of human OPTN. Synthetic peptide located within the following region: SDQQAYLVQRGAEDRDWRQQRNIPIHSCPKCGEVLPDIDTLQIHVMDCII

Carrier-free (BSA/glycerol-free) OPTN mouse monoclonal antibody,clone OTI7H2

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-OPTN Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human OPTN

OPTN rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human OPTN