OR1N1 (C-term) rabbit polyclonal antibody, Purified
Applications | ELISA, IF, IHC |
Reactivities | Human |
Immunogen | OR1N1 antibody was raised against synthetic peptide |
OR1N1 (C-term) rabbit polyclonal antibody, Purified
Applications | ELISA, IF, IHC |
Reactivities | Human |
Immunogen | OR1N1 antibody was raised against synthetic peptide |
Rabbit Polyclonal Anti-OR1N1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-OR1N1 antibody is: synthetic peptide directed towards the C-terminal region of Human OR1N1. Synthetic peptide located within the following region: PPSIASEEKDIAAAAMYTIVTPMLNPFIYSLRNKDMKGALKRLFSHRSIV |