Antibodies

View as table Download

Rabbit Polyclonal Anti-OR2A25 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR2A25 antibody is: synthetic peptide directed towards the C-terminal region of Human OR2A25. Synthetic peptide located within the following region: LCVVGLFYGTAIIMYVEPQYESPKEQKKYLLLFHSLFNPMLNPLIYSLRN

Rabbit Polyclonal Anti-OR2A25 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR2A25 antibody is: synthetic peptide directed towards the C-terminal region of Human OR2A25. Synthetic peptide located within the following region: IIMYVEPQYESPKEQKKYLLLFHSLFNPMLNPLIYSLRNKEVQGTLKRML