Rabbit polyclonal anti-OR2C1 antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human OR2C1. |
Rabbit polyclonal anti-OR2C1 antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human OR2C1. |
Rabbit Polyclonal Anti-OR2C1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-OR2C1 antibody: synthetic peptide directed towards the C terminal of human OR2C1. Synthetic peptide located within the following region: FYGSASYGYLLPAKNSKQDQGKFISLFYSLVTPMVNPLIYTLRNMEVKGA |