Antibodies

Jump to Filters
View as table Download
OR2C3 Rabbit Polyclonal Antibody
TA342707

USD 375.00

5 Days

Rabbit Polyclonal Anti-OR2C3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OR2C3 antibody: synthetic peptide directed towards the C terminal of human OR2C3. Synthetic peptide located within the following region: LFYGSIIFMYLQPAKSTSHEQGKFIALFYTVVTPALNPLIYTLRNTEVKS
OR2C3 Rabbit Polyclonal Antibody
TA357618

USD 360.00

5 Days

OR2C3 Antibody - C-terminal region

Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human OR2C3