Rabbit polyclonal anti-OR2M2 antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human OR2M2. |
Rabbit polyclonal anti-OR2M2 antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human OR2M2. |
Rabbit Polyclonal Anti-OR2M2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-OR2M2 antibody is: synthetic peptide directed towards the middle region of Human OR2M2. Synthetic peptide located within the following region: YYGAALFMYIRPTSDHSPTQDKMVSVFYTILTPMLNPLIYSLRNKEVTRA |
Rabbit Polyclonal Anti-OR2M2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-OR2M2 antibody is: synthetic peptide directed towards the C-terminal region of Human OR2M2. Synthetic peptide located within the following region: DKMVSVFYTILTPMLNPLIYSLRNKEVTRAFMKILGKGKSESELPHKLYV |
Rabbit Polyclonal Anti-OR2M2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-OR2M2 antibody: synthetic peptide directed towards the C terminal of human OR2M2. Synthetic peptide located within the following region: KEVTRAFMKILGKGKSESELPHKLYVLLFAKFFFLISIFFYDVKILALIM |
OR2M2 Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |