Antibodies

Jump to Filters
View as table Download
OR2S2 Rabbit Polyclonal Antibody
TA337495

USD 375.00

5 Days

Rabbit Polyclonal Anti-OR2S2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR2S2 antibody is: synthetic peptide directed towards the C-terminal region of Human OR2S2. Synthetic peptide located within the following region: KKVFSTCSAHLTVVIVFYGTLFFMYGKPKSKDSMGADKEDLSDKLIPLFY
OR2S2 Rabbit Polyclonal Antibody
TA379489

USD 220.00

3 Weeks

OR2S2 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human OR2S2 (NP_063950.2).
Modifications Unmodified