Antibodies

View as table Download

Rabbit polyclonal anti-OR4E2 antibody

Applications IF
Reactivities Human
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR4E2.

Rabbit Polyclonal Anti-OR4E2 Antibody

Applications WB
Reactivities Human
Immunogen The immunogen for Anti-OR4E2 antibody is: synthetic peptide directed towards the C-terminal region of Human OR4E2. Synthetic peptide located within the following region: RPDTSFSIDKVVSVFYTVVTPLLNPFIYTLRNEEVKSAMKQLRQRQVFFT