Antibodies

Jump to Filters
View as table Download
OR4F4 Rabbit Polyclonal Antibody
TA315342

USD 345.00

In Stock

Rabbit polyclonal anti-OR4F4 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human OR4F4.
OR4F4 Rabbit Polyclonal Antibody
TA337505

USD 375.00

5 Days

Rabbit Polyclonal Anti-OR4F4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR4F4 antibody is: synthetic peptide directed towards the C-terminal region of Human OR4F4. Synthetic peptide located within the following region: PIKSLDKFLAVFYSVITPLLNPIIYTLRNKDMKTAIRRLRKWDAHSSVKF