Antibodies

Jump to Filters
View as table Download
OR4N2 (N-term) Rabbit Polyclonal Antibody
AP53064PU-N

USD 450.00

2 Weeks

OR4N2 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 67-97 amino acids from the N-terminal region of human Olfactory receptor 4N2
OR4N2 Rabbit Polyclonal Antibody
TA337513

USD 375.00

5 Days

Rabbit Polyclonal Anti-OR4N2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR4N2 antibody is: synthetic peptide directed towards the C-terminal region of Human OR4N2. Synthetic peptide located within the following region: YTRPFRAFPADKVVSLFHTVIFPLLNPVIYTLRNQEVKASMKKVFNKHIA