Antibodies

Jump to Filters
View as table Download
OR4Q3 (C-term) Rabbit Polyclonal Antibody
AP53067PU-N

USD 450.00

2 Weeks

OR4Q3 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 277-307 amino acids from the C-terminal region of human Olfactory receptor 4Q3
OR4Q3 Rabbit Polyclonal Antibody
TA337509

USD 375.00

5 Days

Rabbit Polyclonal Anti-OR4Q3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR4Q3 antibody is: synthetic peptide directed towards the C-terminal region of Human OR4Q3. Synthetic peptide located within the following region: CVFIYLRPFCSFSVDKIFSLFYTVITPMLNPLIYTLRNTDMKTAMKKLRI