Antibodies

Jump to Filters
View as table Download
OR4X2 Rabbit Polyclonal Antibody
TA337510

USD 375.00

5 Days

Rabbit Polyclonal Anti-OR4X2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR4X2 antibody is: synthetic peptide directed towards the N-terminal region of Human OR4X2. Synthetic peptide located within the following region: FLVLSPNQEVQRVCFVIFLFLYTAIVLGNFLIVLTVMTSRSLGSPMYFFL