Antibodies

View as table Download

Rabbit polyclonal anti-OR51A2 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR51A2.

Rabbit Polyclonal Anti-OR51A2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR51A2 Antibody is: synthetic peptide directed towards the N-terminal region of Human OR51A2. Synthetic peptide located within the following region: LSMLAMSDLGLSLSSLPTVLSIFLFNAPETSSSACFAQEFFIHGFSVLES