Antibodies

View as table Download

Rabbit polyclonal anti-OR52B2 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR52B2.

Rabbit Polyclonal Anti-OR52B2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR52B2 Antibody is: synthetic peptide directed towards the C-terminal region of Human OR52B2. Synthetic peptide located within the following region: LDVILIAVSYSLILRAVFRLPSQDARHKALSTCGSHLCVILMFYVPSFFT