Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-OR52E2 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human OR52E2. |
Antibodies
View as table Download
OR52E2 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 303-325 amino acids from the C-terminal region of human Olfactory receptor 52E2 |
Rabbit Polyclonal Anti-OR52E2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-OR52E2 Antibody is: synthetic peptide directed towards the C-terminal region of Human OR52E2. Synthetic peptide located within the following region: RYIHILLANLYVVVPPMLNPVIYGVRTKQIYKCVKKILLQEQGMEKEEYL |
Active filters
Target Symbol
- OR52E2