Antibodies

View as table Download

OR52I2 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 312-341 amino acids from the C-terminal region of human OR52I2

Rabbit Polyclonal Anti-OR52I2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR52I2 Antibody is: synthetic peptide directed towards the N-terminal region of Human OR52I2. Synthetic peptide located within the following region: SSVVPKMVSIFCSGDSSISFSACFTQMFFVHLATAVETGLLLTMAFDRYV