Antibodies

Jump to Filters
View as table Download
OR5D13 (Center) Rabbit Polyclonal Antibody
AP53088PU-N

USD 450.00

2 Weeks

OR5D13 (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 171-199 amino acids from the Central region of human Olfactory receptor 5D13
OR5D13 Rabbit Polyclonal Antibody
TA337522

USD 375.00

5 Days

Rabbit Polyclonal Anti-OR5D13 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR5D13 antibody is: synthetic peptide directed towards the C-terminal region of Human OR5D13. Synthetic peptide located within the following region: YCVPNPKTSSLIVTVASVFYTVAIPMLNPLIYSLRNKDINNMFEKLVVTK