OR5H2 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 182-312 amino acids from the C-terminal region of human Olfactory receptor 5H2 |
OR5H2 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 182-312 amino acids from the C-terminal region of human Olfactory receptor 5H2 |
Rabbit Polyclonal Anti-OR5H2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-OR5H2 antibody is: synthetic peptide directed towards the C-terminal region of Human OR5H2. Synthetic peptide located within the following region: GAHLLSVSLYYGPLIFMYLRPASPQADDQDMIDSVFYTIIIPLLNPIIYS |