Antibodies

View as table Download

OR5H2 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 182-312 amino acids from the C-terminal region of human Olfactory receptor 5H2

Rabbit Polyclonal Anti-OR5H2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR5H2 antibody is: synthetic peptide directed towards the C-terminal region of Human OR5H2. Synthetic peptide located within the following region: GAHLLSVSLYYGPLIFMYLRPASPQADDQDMIDSVFYTIIIPLLNPIIYS