Antibodies

Jump to Filters
View as table Download
OR6K6 Rabbit Polyclonal Antibody
TA337537

USD 375.00

5 Days

Rabbit Polyclonal Anti-OR6K6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR6K6 antibody is: synthetic peptide directed towards the C-terminal region of Human OR6K6. Synthetic peptide located within the following region: TYSVFWDTAIAVTFVILAPFFNPIIYSLKNKDMKEAIGRLFHYQKRAGWA