Antibodies

Jump to Filters
View as table Download
OR7A5 Rabbit Polyclonal Antibody
TA331895

USD 375.00

5 Days

Rabbit Polyclonal Anti-OR7A5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR7A5 Antibody is: synthetic peptide directed towards the C-terminal region of Human OR7A5. Synthetic peptide located within the following region: YLSSAATRNSHSSATASVMYTVVTPMLNPFIYSLRNKDIKRALGIHLLWG
OR7A5 Rabbit Polyclonal Antibody
TA360413

USD 360.00

5 Days

OR7A5 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human OR7A5