Antibodies

Jump to Filters
View as table Download
OR7G1 (N-term) Rabbit Polyclonal Antibody
AP53104PU-N

USD 450.00

2 Weeks

OR7G1 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 2-32 amino acids from the N-terminal region of human OR7G1
OR7G1 Rabbit Polyclonal Antibody
TA337543

USD 375.00

5 Days

Rabbit Polyclonal Anti-OR7G1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR7G1 antibody is: synthetic peptide directed towards the C-terminal region of Human OR7G1. Synthetic peptide located within the following region: AFGVYISSAVAESSRITAVASVMYTVVPQMMNPFIYSLRNKEMKKALRKL