Antibodies

Jump to Filters
View as table Download
OR8D2 Rabbit Polyclonal Antibody
TA332339

USD 375.00

5 Days

Rabbit Polyclonal Anti-OR8D2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR8D2 Antibody is: synthetic peptide directed towards the C-terminal region of Human OR8D2. Synthetic peptide located within the following region: PPSSTTMEKEKVSSVFYITIIPMLNPLIYSLRNKDVKNALKKMTRGRQSS