Antibodies

Jump to Filters
View as table Download
OR9I1 Rabbit Polyclonal Antibody
TA332289

USD 375.00

5 Days

Rabbit Polyclonal Anti-OR9I1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR9I1 Antibody is: synthetic peptide directed towards the C-terminal region of Human OR9I1. Synthetic peptide located within the following region: VKSSGGRAKTFSTCASHITAVALFFGALIFMYLQSGSGKSLEEDKVVSVF