Antibodies

Jump to Filters
View as table Download
ORAI3 Mouse Monoclonal Antibody [Clone ID: 2H2G9]
TA320075

USD 430.00

5 Days

Mouse ORAI3 Monoclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
ORAI3 Rabbit Polyclonal Antibody
TA306430

USD 430.00

In Stock

Rabbit Polyclonal ORAI3 Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen ORAI3 antibody was raised against a 19 amino acid peptide from near the carboxy terminus of human ORAI3.
ORAI3 Rabbit Polyclonal Antibody
TA306420

USD 430.00

5 Days

Rabbit Polyclonal ORAI3 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen ORAI3 antibody was raised against a 15 amino acid peptide from near the amino terminus of human ORAI3.
Orai3 Rabbit Polyclonal Antibody
TA328753

USD 585.00

3 Weeks

Rabbit Polyclonal Anti-Orai3

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)REFVHRGYLDLMGAS, corresponding to amino acid residues 28-42 of rat Orai3. Intracellular, N-terminus.
ORAI3 Mouse Monoclonal Antibody [Clone ID: 1B4F1]
TA320076

USD 430.00

5 Days

Mouse ORAI3 Monoclonal Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
ORAI3 Rabbit Polyclonal Antibody
TA337882

USD 375.00

5 Days

Rabbit Polyclonal Anti-ORAI3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ORAI3 antibody is: synthetic peptide directed towards the N-terminal region of Human ORAI3. Synthetic peptide located within the following region: GDAGEQAPLNPEGESPAGSATYREFVHRGYLDLMGASQHSLRALSWRRLY
ORAI3 Rabbit Polyclonal Antibody
TA358702

USD 360.00

5 Days

ORAI3 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated