Antibodies

Jump to Filters
View as table Download
OST4 Rabbit Polyclonal Antibody
TA338306

USD 375.00

5 Days

Rabbit Polyclonal Anti-OST4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OST4 antibody is: synthetic peptide directed towards the C-terminal region of Human OST4. Synthetic peptide located within the following region: MITDVQLAIFANMLGVSLFLLVVLYHYVAVNNPKKQE