Rabbit Polyclonal OVGP1 Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | OVGP1 antibody was raised against an 18 amino acid synthetic peptide from near the amino terminus of human OVGP1. The immunogen is located within amino acids 60 - 110 of OVGP1. |
Rabbit Polyclonal Anti-OVGP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OVGP1 antibody: synthetic peptide directed towards the C terminal of human OVGP1. Synthetic peptide located within the following region: QLPEQTPLAFDNRFVPIYGNHSSVNSVTPQTSPLSLKKEIPENSAVDEEA |
OVGP1 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 22-260 of human OVGP1 (NP_002548.3). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
