Antibodies

View as table Download

Rabbit Polyclonal Anti-OCIAD1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OCIAD1 antibody: synthetic peptide directed towards the C terminal of human OCIAD1. Synthetic peptide located within the following region: QGPDPNLEESPKRKNITYEELRNKNRESYEVSLTQKTDPSVRPMHERVPK

OCIAD1 (C-term) rabbit polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human
Immunogen Synthetic peptide - KLH conjugated

Rabbit Polyclonal OCIAD1 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen OCIAD1 antibody was raised against a 16 amino acid peptide from near the carboxy terminus of human OCIAD1.

Rabbit Polyclonal Anti-OCIAD1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human OCIAD1

OCIAD1 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human OCIAD1

OCIAD1 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-245 of human OCIAD1 (NP_060300.1).
Modifications Unmodified