Germany
Japan
United Kingdom
China
Antibodies
View as table Download
ODF2 rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Chimpanzee, Human, Monkey |
| Immunogen | Synthetic peptide corresponding to residues near the carboxy terminus |
ODF2 pSer796 rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Chimpanzee, Human, Monkey |
| Immunogen | Synthetic peptide corresponding to residues near S796 of human cenexin-1 |
Rabbit Polyclonal Anti-ODF2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ODF2 Antibody: synthetic peptide directed towards the N terminal of human ODF2. Synthetic peptide located within the following region: MSASSSGGSPRFPSCGKNGVTSLTQKKVLRAPCGAPSVTVTKSHKRGMKG |
Goat Anti-ODF2 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-REKHQASQKENKQ, from the internal region of the protein sequence according to NP_002531.3; NP_702915.1. |
Rabbit polyclonal Cenexin-1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This protein-A purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a truncated recombinant protein hCenexin1. |
Rabbit Polyclonal Anti-ODF2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ODF2 Antibody: synthetic peptide directed towards the N terminal of human ODF2. Synthetic peptide located within the following region: TCTDINTLTRQKELLLQKLSTFEETNRTLRDLLREQHCKEDSERLMEQQG |
ODF2 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ODF2 |
Active filters
Target Symbol
- ODF2