Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal ORAI1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | ORAI1 antibody was raised against a 16 amino acid synthetic peptide from near the carboxy terminus of human ORAI1. The immunogen is located within the last 50 amino acids of ORAI1. |
Goat Anti-ORAI1 / CRACM1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KKQPGQPRPTSKP, from the internal region of the protein sequence according to NP_116179.2. |
Rabbit Polyclonal Anti-ORAI1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ORAI1 antibody: synthetic peptide directed towards the N terminal of human ORAI1. Synthetic peptide located within the following region: HPEPAPPPSRSSPELPPSGGSTTSGSRRSRRRSGDGEPPGAPPPPPSAVT |
Rabbit Polyclonal Anti-ORAI1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ORAI1 antibody: synthetic peptide directed towards the middle region of human ORAI1. Synthetic peptide located within the following region: IGTLLFLAEVVLLCWVKFLPLKKQPGQPRPTSKPPASGAAANVSTSGITP |
Rabbit Polyclonal Anti-ORAI1(L1) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ORAI1(L1) |
Rabbit Polyclonal Anti-ORAI1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ORAI1 |
ORAI1(L1) rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ORAI1(L1) |
ORAI1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 202-301 of human ORAI1 (NP_116179.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- ORAI1