Antibodies

View as table Download

Rabbit Polyclonal Anti-OSCP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OSCP1 antibody: synthetic peptide directed towards the N terminal of human OSCP1. Synthetic peptide located within the following region: MSVRTLPLLFLNLGGEMLYILDQRLRAQNIPGDKARKDEWTEVDRKRVLN

Rabbit Polyclonal Anti-OSCP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OSCP1 antibody: synthetic peptide directed towards the N terminal of human OSCP1. Synthetic peptide located within the following region: ARKVLNDIISTMFNRKFMEELFKPQELYSKKALRTVYERLAHASIMKLNQ