Antibodies

Jump to Filters
View as table Download
OSGIN1 Rabbit Polyclonal Antibody
TA342142

USD 375.00

5 Days

Rabbit polyclonal Anti-OSGIN1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OSGIN1 antibody: synthetic peptide directed towards the N terminal of human OSGIN1. Synthetic peptide located within the following region: APGVSILDQDLDYLSEGLEGRSQSPVALLFDALLRPDTDFGGNMKSVLTW
OSGIN1 Rabbit Polyclonal Antibody
TA379515

USD 220.00

3 Weeks

OSGIN1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human OSGIN1 (NP_892026.1).