Antibodies

Jump to Filters
View as table Download
OTUD6B Rabbit Polyclonal Antibody
TA345081

USD 475.00

5 Days

Rabbit Polyclonal Anti-OTUD6B Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OTUD6B antibody: synthetic peptide directed towards the middle region of human OTUD6B. Synthetic peptide located within the following region: EIIQADSPPIIVGEEYSKKPLILVYMRHAYGLGEHYNSVTRLVNIVTENC
OTUD6B Rabbit Polyclonal Antibody
TA379531

USD 220.00

3 Weeks

OTUD6B Rabbit polyclonal Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 31-323 of human OTUD6B (NP_057107.3).
Modifications Unmodified