Germany
Japan
United Kingdom
China
Antibodies
View as table Download
P2RY1 / P2Y1 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gorilla, Human |
| Immunogen | P2RY1 / P2Y1 antibody was raised against synthetic 18 amino acid peptide from N-terminal extracellular domain of human P2RY1 / P2Y1. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Gibbon, Monkey, Mouse (94%); Marmoset, Rat, Hamster, Bovine (89%); Rabbit, Pig (83%). |
Rabbit Polyclonal Anti-P2RY1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-P2RY1 antibody: synthetic peptide directed towards the N terminal of human P2RY1. Synthetic peptide located within the following region: VAIWMFVFHMKPWSGISVYMFNLALADFLYVLTLPALIFYYFNKTDWIFG |
Anti-P2RY1 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 256-269 amino acids of Human purinergic receptor P2Y, G-protein coupled, 1 |
P2ry1 Antibody - middle region
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
P2RY1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 274-373 of human P2RY1 (NP_002554.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- P2RY1