Germany
Japan
United Kingdom
China
Rabbit Polyclonal Anti-P2Y14 Receptor (extracellular)
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide CIELKSELGRKWHKASN, corresponding to amino acid residues 172-188 of human P2Y14. 2nd extracellular loop. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-P2RY14 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-P2RY14 antibody is: synthetic peptide directed towards the C-terminal region of Human P2RY14. Synthetic peptide located within the following region: YTKSQTEAHYSCQSKEILRYMKEFTLLLSAANVCLDPIIYFFLCQPFREI |
Rabbit Polyclonal Anti-P2RY14 Antibody (Extracellular Domain)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | P2RY14 / GPR105 antibody was raised against synthetic 16 amino acid peptide from 2nd extracellular domain of human P2RY14 / P2Y14. Percent identity with other species by BLAST analysis: Human (100%); Monkey, Marmoset, Mouse (94%); Rat, Hamster, Panda, Dog, Bat, Rabbit, Pig (88%); Bovine, Horse (81%). |
P2RY14 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
P2RY14 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human P2RY14 |
P2RY14 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 209-338 of human P2RY14 (NP_055694.3). |
| Modifications | Unmodified |
Active filters
Target Symbol
- P2RY14