Germany
Japan
United Kingdom
China
P2RY4 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human P2RY4 |
TA371772 is a possible alternative to TA321501.
Antibodies
View as table Download
Rabbit polyclonal anti-P2RY4 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human P2RY4. |
Rabbit Polyclonal Anti-P2RY4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-P2RY4 Antibody is: synthetic peptide directed towards the C-terminal region of Human P2RY4. Synthetic peptide located within the following region: VTRPLASANSCLDPVLYLLTGDKYRRQLRQLCGGGKPQPRTAASSLALVS |
Rabbit Polyclonal Anti-P2RY4 Antibody (Cytoplasmic Domain)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | P2RY4 / P2Y4 antibody was raised against synthetic 14 amino acid peptide from 1st cytoplasmic domain of human P2RY4 / P2Y4. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Mouse, Rat, Hamster, Panda, Bovine (93%); Rabbit, Pig, Opossum (86%). |
P2RY4 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human P2RY4 |
Active filters
Target Symbol
- P2RY4