Germany
Japan
United Kingdom
China
Rabbit Polyclonal PHD4/HIF Prolyl Hydroxylase 4 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-PH-4 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PH-4 antibody: synthetic peptide directed towards the middle region of human PH-4. Synthetic peptide located within the following region: GHYHAHVDSGPVYPETICSHTKLVANESVPFETSCRYMTVLFYLNNVTGG |
Rabbit Polyclonal Anti-PH-4 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PH-4 antibody: synthetic peptide directed towards the middle region of human PH-4. Synthetic peptide located within the following region: RLGNGWWMTPESIQEMYAAIKADPDGDGVLSLQEFSNMDLRDFHKYMRSH |
Active filters
Target Symbol
- P4HTM