Antibodies

Jump to Filters
View as table Download
P4HB Rabbit Polyclonal Antibody
TA308403

USD 415.00

2 Weeks

Rabbit Polyclonal antibody to PDI (prolyl 4-hydroxylase, beta polypeptide)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 23 and 227 of PDI (Uniprot ID#P07237)
P4HB Rabbit Polyclonal Antibody
TA349075

USD 484.00

5 Days

Rabbit Polyclonal Anti-PARK2 Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen PARK2 antibody was raised against a 17 amino acid peptide near the amino terminus of human PARK2
P4HB Rabbit Polyclonal Antibody
TA346538

USD 475.00

5 Days

Rabbit Polyclonal Anti-P4HB Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-P4HB antibody: synthetic peptide directed towards the N terminal of human P4HB. Synthetic peptide located within the following region: TIKFFRNGDTASPKEYTAGREADDIVNWLKKRTGPAATTLPDGAAAESLV
P4HB Rabbit Polyclonal Antibody
TA326851

USD 410.00

3 Weeks

Rabbit anti-P4HB Polyclonal Antibody

Applications ELISA, ICC/IF, IF, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
P4hb Mouse Monoclonal Antibody [Clone ID: 6-9H6]
TA363861

USD 635.00

2 Weeks

Prolyl 4-Hydroxylase beta (protein disulfide isomerase, fibroblasts), mouse anti rat, clone 6-9H6

Applications ELISA, IHC
Reactivities Rat
Conjugation Unconjugated
P4HB Rabbit Polyclonal Antibody
TA346539

USD 475.00

5 Days

Rabbit Polyclonal Anti-P4HB Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-P4HB antibody: synthetic peptide directed towards the C terminal of human P4HB. Synthetic peptide located within the following region: DRTVIDYNGERTLDGFKKFLESGGQDGAGDDDDLEDLEEAEEPDMEEDDD
P4HB (C-term) Rabbit Polyclonal Antibody
AP17615PU-N

USD 512.00

2 Weeks

P4HB (C-term) rabbit polyclonal antibody

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 436~464 amino acids from the C-terminal region of Human P4HB.
P4HB Rabbit Polyclonal Antibody
TA321235

USD 345.00

4 Weeks

Anti-P4HB Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 180 amino acids of human prolyl 4-hydroxylase, beta polypeptide
P4HB Mouse Monoclonal Antibody [Clone ID: 3G5]
TA355380

USD 300.00

5 Days

P4HB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
P4HB Mouse Monoclonal Antibody [Clone ID: 9C7]
TA355393

USD 300.00

5 Days

P4HB Antibody

Applications WB
Conjugation Unconjugated
P4hb Rabbit Polyclonal Antibody
TA363127

USD 360.00

5 Days

P4HB Antibody - C-terminal region

Applications WB
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of mouse P4HB
P4HB Rabbit Monoclonal Antibody [Clone ID: R09-1F4]
TA384917

USD 380.00

4 Weeks

P4HB Rabbit monoclonal Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
P4HB Rabbit Monoclonal Antibody [Clone ID: R08-6I8]
TA384918

USD 380.00

4 Weeks

P4HB Rabbit monoclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated