Rabbit Polyclonal Anti-PABPC4 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PABPC4 antibody: synthetic peptide directed towards the N terminal of human PABPC4. Synthetic peptide located within the following region: AELGAKAKEFTNVYIKNFGEEVDDESLKELFSQFGKTLSVKVMRDPNGKS |
Rabbit Polyclonal Anti-PABPC4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PABPC4 antibody: synthetic peptide directed towards the middle region of human PABPC4. Synthetic peptide located within the following region: RPNPRWQQGGRPQGFQGMPSAIRQSGPRPTLRHLAPTGSECPDRLAMDFG |
PABPC4 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human PABPC4 |
polyclonal AntibodyPC4 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 350-450 of human PABPC4 (NP_003810.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
