Antibodies

Jump to Filters
View as table Download
PACSIN1 Goat Polyclonal Antibody
TA302751

USD 375.00

5 Days

Goat Polyclonal Antibody against PACSIN1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence SSSYDEASLAPEET-C, from the N Terminus of the protein sequence according to NP_065855.1.
PACSIN1 Rabbit Polyclonal Antibody
TA330001

USD 310.00

5 Days

Rabbit Polyclonal Anti-PACSIN1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PACSIN1 antibody: synthetic peptide directed towards the C terminal of human PACSIN1. Synthetic peptide located within the following region: HTTTKKEKQPKKAEGVALTNATGAVESTSQAGDRGSVSSYDRGQPYATEW
PACSIN1 Rabbit Polyclonal Antibody
TA379570

USD 220.00

3 Weeks

PACSIN1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 240-390 of human PACSIN1 (NP_065855.1).
Modifications Unmodified