Antibodies

View as table Download

Rabbit Polyclonal Anti-PAFAH1B2 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PAFAH1B2 antibody: synthetic peptide directed towards the N terminal of human PAFAH1B2. Synthetic peptide located within the following region: MSQGDSNPAAIPHAAEDIQGDDRWMSQHNRFVLDCKDKEPDVLFVGDSMV

PAFAH1B2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PAFAH1B2

PAFAH1B2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PAFAH1B2

PAFAH1B2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-229 of human PAFAH1B2 (NP_002563.1).
Modifications Unmodified