PAICS (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 94-123 amino acids from the N-terminal region of human PAICS |
PAICS (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 94-123 amino acids from the N-terminal region of human PAICS |
Rabbit Polyclonal Anti-PAICS Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PAICS antibody: synthetic peptide directed towards the N terminal of human PAICS. Synthetic peptide located within the following region: ATAEVLNIGKKLYEGKTKEVYELLDSPGKVLLQSKDQITAGNAARKNHLE |
Carrier-free (BSA/glycerol-free) PAICS mouse monoclonal antibody, clone OTI5B6 (formerly 5B6)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PAICS mouse monoclonal antibody, clone OTI1B4 (formerly 1B4)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PAICS mouse monoclonal antibody, clone OTI8A1 (formerly 8A1)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PAICS mouse monoclonal antibody, clone OTI2C9 (formerly 2C9)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-PAICS Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human PAICS |
PAICS rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human PAICS |
PAICS Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 176-425 of human PAICS (NP_001072992.1). |
Modifications | Unmodified |
Anti-PAICS mouse monoclonal antibody, clone OTI5B6 (formerly 5B6)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
Anti-PAICS mouse monoclonal antibody, clone OTI5B6 (formerly 5B6), Biotinylated
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
Anti-PAICS mouse monoclonal antibody, clone OTI5B6 (formerly 5B6), HRP conjugated
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Anti-PAICS mouse monoclonal antibody, clone OTI5B6 (formerly 5B6)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PAICS mouse monoclonal antibody, clone OTI1B4 (formerly 1B4)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
PAICS mouse monoclonal antibody, clone OTI1B4 (formerly 1B4), Biotinylated
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
PAICS mouse monoclonal antibody, clone OTI1B4 (formerly 1B4), HRP conjugated
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
PAICS mouse monoclonal antibody, clone OTI1B4 (formerly 1B4)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-PAICS mouse monoclonal antibody, clone OTI8A1 (formerly 8A1)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
Anti-PAICS mouse monoclonal antibody, clone OTI8A1 (formerly 8A1), Biotinylated
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
Anti-PAICS mouse monoclonal antibody, clone OTI8A1 (formerly 8A1), HRP conjugated
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Anti-PAICS mouse monoclonal antibody, clone OTI8A1 (formerly 8A1)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-PAICS mouse monoclonal antibody, clone OTI2C9 (formerly 2C9)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
Anti-PAICS mouse monoclonal antibody, clone OTI2C9 (formerly 2C9), Biotinylated
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
Anti-PAICS mouse monoclonal antibody, clone OTI2C9 (formerly 2C9), HRP conjugated
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Anti-PAICS mouse monoclonal antibody, clone OTI2C9 (formerly 2C9)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |