Antibodies

Jump to Filters
View as table Download
Pannexin 2 (PANX2) Rabbit Polyclonal Antibody
TA328663

USD 585.00

3 Weeks

Rabbit Polyclonal Anti-Pannexin 2 (extracellular)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)EEPIY(S)YTPHNFTRD, corresponding to amino acid residues 76-90 of human Pannexin 2. 1st extracellular loop.
Pannexin 2 (PANX2) Rabbit Polyclonal Antibody
TA329533

USD 310.00

5 Days

Rabbit Polyclonal anti-PANX2 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PANX2 antibody: synthetic peptide directed towards the N terminal of human PANX2. Synthetic peptide located within the following region: GTVLVPILLVTLVFTKNFAEEPIYCYTPHNFTRDQALYARGYCWTELRDA